213 Puszczać, Puszcza, Pusty, Pustka, Puszta, Pustynia, Puchacz, Puszczyk, Puch, Puszek i inne dowody na pierwotną oboczność Pra-Słowiańskich rdzeni i wtórne ubezdźwięcznienia

puszcza (1.1)


Puszczalstwo obocznie ofitzjalnie niemożliwe

Puść dalej, że na Pustej Puszcie i w Pustyni i Puszczy,
Pusto Puszczają się jednocześnie bezdźwięczny Puchacz i dźwięczny Puszczyk.
No co, Puścisz?

O pierwotnej oboczności rdzeni języka Pra-Słowiańskiego i wtórnych ubezdźwięcznieniach ciąg dalszy i długo jeszcze pewno nie ustający.

Zwracam ponownie uwagę, na tradycyjnie już wtórnie ubezdźwięcznione postacie Pra-Słowiańskich słów, które występują w języku czeskim, ale i nie tylko. Ogólnie rzecz biorąc, znów piję do braku dowodów na te rzekome tzw. palatalizacje słowiańskie, a szczególnie na tę ostatnią trzecią, rzekomo z tzw. 13w, którą dla rozróżnienia nazywam „lechicką”.

Dowody wskazują na pierwotną oboczność rdzeni Pra-Słowiańskich. Rzekome palatalizacje słowiańskie, a szczególnie bardzo, bardzo liczne wyjątki od tej trzeciej, ofitzjalne niezgrabnie tłumaczy się, jako zachodzące, a raz niezachodzące.

To, coś jakby grawitacja raz działała,.. a raz nie…

Tu trochę do poczytania o czasem działających, a czasem niedziałających „prawach językowych”:


As the Proto-Indo-European language (PIE) broke up, its sound system diverged as well, as evidenced in various sound laws associated with the daughter Indo-European languagesEspecially notable is the palatalization that produced the satem languages, along with the associated ruki sound law.  (…)

Click to access 18616457.pdf

System PIE The Primary Phoneme Inventory and Sound Law System for Proto-Indo-European
Jouna Pyysalo



Exceptions in Slavic languages

In Slavic languages the process is regular before a vowel, but it does not take place before consonants. The final result is the voiceless velar fricative *x, which is even more retracted than the *š. This velar fricative changed back into  before a front vowel or the palatal approximant *y. (…)

Click to access ruki%20rule%20and%20x-%20slavonicum.pdf

Initial *x- in Slavic revisited
Jan Bičovský

(…) The phonetic proceses involved in this change should be studied in sequence and in relation to the relevant parts of the phonological system in each stage. They are not causally related to the ruki-rule nor are they necessarily results of affective change. (…)

Te i inne ofitzjalne fyfody, jak np. tzw. laryngały, to jest zwykłe oszustwo. Polega ono na bardzo prostym zabiegu. Za rzekomo wyjściowy stan pierwotny tego odtfoszonego tzw. PIE, 19 wieczni fielko-germańscy jęsykosnaftzy przyjęli sobie w przeważającej większości wtórnie ubezdźwięcznione postacie rdzeni i słów. Sami sobie je też odtfoszyli na podstawie wtórnie ubezdźwięcznionych słów z sanskrytu, tzw. greki, czy innych podobnie późno zniekształconych języków kreolskich, jak np. języki italo-celtyckie, czy germańskie.

Do tego dochodzi jeszcze późne wtórne ubezdźwięcznienie gwar języków słowiańskich, jak czeski, słowacki, rosyjski, ukraiński, czy gwary południowe, traktowane ofitzjalnie jako wcześniejsze,.. bo… ubezdźwięcznione!

Aczkolwiek… nielogiczności, przemilczenia i liczne wyjątki, wyraźnie wskazują gdzie Pra-Słowiańskie rdzenie zimowały i nadal zimują! 🙂

Inne tytuły tego wpisu:

213 Peys, Piasta, Pieścić, Pizda, Pięść, Pięć, Piędź, Pięta, Pętać i inne dowody na pierwotną oboczność Pra-Słowiańskich rdzeni 10

213 Wtórnie ubezdźwięcznione liczebniki indogermańskie i ich wysokoenergetyczne PieRwotne PRa-Słowiańskie rdzenie, PieR+WS”y, PRW, PR 21



Puszcza (dawniej pustkowie lub dzicz)[1] – wielki, niezamieszkany obszar porośnięty lasami lub borami. Pierwotne puszczańskie drzewostany były bardzo bogate pod względem składu gatunkowego i struktury warstwowej. Rosły tam nie tylko stare, potężne drzewa, ale również wiele krzewów, mniejszych, osłoniętych od światła drzew, bogate runo oraz młode drzewa, które urosły między leżącymi pniami.

Obszar Polski porastała niegdyś puszcza, ciągnąca się od stepów wschodu po zachodnioeuropejskie lasy liściaste. Lasy te były bogate w zwierzynę. Żyły w nich m.in. turyżubryniedźwiedziełosiewilkirysie oraz żbiki.

  1.  Witold Doroszewski (red.): puszcza. W: Słownik języka polskiego [on-line]. PWN. [dostęp 2016-03-03].




Puszcza / Po’S”+C”a


puszcza (język polski)

puszcza (1.1)

rzeczownik, rodzaj żeński

(1.1) dzikipierwotny las o dużej powierzchnizob. też puszcza w Wikipedii
(1.2) daw. pustkowie

czasownik, forma fleksyjna

(2.1) 3. os. lp tryb oznajmujący od: puszczać

(2.1) zob. puszczać
(1.2) A Mojżesz pasł trzodę Jetraświekra swegokapłana Madyjańskiegoi zagnał trzodę na puszcząa przyszedł do góry Bożejdo Horeb (…)[1] (sic!)
(1.2) daw. pustynia
(1.1) las
wyrazy pokrewne:
rzecz. pustynnienie npustelniczka żpuszczak mPuszczak mpustkowie npuszczyk mpustelnik mpustka żpustynia żpuszczanin mospustelnica ż
przym. puszczański
związki frazeologiczne:
gdy jeleń wejdzie w moją puszczę, to jeleń mój • głos wołającego na puszczy • lepszy zając w miechu od niedźwiedzia w puszczy • nie podobała się Żydom na puszczy manna
prasł. *puťa < prasł. *pȗstъ
(1.1) zob. też puszcza w Wikicytatach
(1.2) zobacz listę tłumaczeń w haśle: pustkowie
  1.  Stary Testament, Księga Wyjścia 3:1, przekład Biblii gdańskiej


Nic o tej rzekomej prasł. *puťa nie znalazłem. Dziwne, że anglojęzyczna wiki podaje dźwięczne pierwowzór dla tego słowa, patrz poniżej!

Czy rzekoma prasł. *puťa logicznie nie znaczy, że wg polskiej wiki zanikł dźwięk zapisywany znakiem S, a  jednocześnie ponownie nastąpiła „depalatalizaja słowiańska, a właściwie lechicka”, patrz Proto-Slavic *pušča  widoczna w angielskojęzycznej wiki?!! 😈





Polish Wikipedia has an article on: Puszcza


From Proto-Slavic *pušča.


puszcza f

  1. primeval forest
    Puszcza Białowieska – Białowieża Forest
  2. (archaic) wildernesswasteland
Related terms
See also


  1. third-person singular present of puszczać
Further reading
  • puszcza in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • puszcza in Polish dictionaries at PWN



Wiktionary does not yet have a reconstruction page for Proto-Slavic/pušča.


Dla porównania:









Widać z jakiego rdzenia pochodzi słowo Puszcza / Po’S”+C”a?

Widać, że j. białoruski i słoweński zachowały pierwotną postać Pra-Słowiańskiego rdzenia PS+C”, podczas gdy j. rosyjski, ukraiński utraciły dźwięk zapisywany znakiem C”, a języki jak czeski, (także słowacki), itd utraciły cały ten rdzeń zupełnie?!!

Dla porównania inne słowo, które ofitzjalnie ma przecież związek ze słowem Puszcza / Po’S”+C”a.


Puszczyk / Po’S”+C”+yK


puszczyk (język polski)

puszczyk (1.1)

IPA[ˈpuʃʧ̑ɨk]AS[puščyk] wymowa ?/i

rzeczownik, rodzaj męskozwierzęcy

(1.1) ornit. Strix aluco[1]najczęściej spotykana europejska sowa o donośnym hukaniuzob. też puszczyk w Wikipedii

(1.1) gw. (Górny Śląsk) katus
(1.1) puszczyk uralskipuszczyk zwyczajny
wyrazy pokrewne:
rzecz. puszczykowate nmospuszcza ż
(1.1) zobacz też: Indeks:Polski – Ptaki
  1.  publikacja w otwartym dostępie – możesz ją przeczytać Hasło Strix aluco w: Wikispecies – otwarty, wolny katalog gatunków, Wikimedia.






Polish Wikipedia has an article on: puszczyk


puszcza +‎ -yk

  • IPA(key)/ˈpuʂ.t͡ʂɨk/

puszczyk m anim

  1. tawny owl
Further reading
  • puszczyk in Polish dictionaries at PWN


Wg powyższego polski dźwięczny Puszczyk / Po’S”+C”+yK pochodzi od dźwięcznej prasłowiańskiej Puszczy / Po’S”+C”+y.

Ciekawe, że już czeski bezdźwięczny Pustik / Po’S”+T+iK, nie pochodzi od tego samego słowa, (no bo je przecież utracił…), ale od dziwnie jakoś ciągle niespalatalizowanego słowa Pusty / Po’S+Ty, czy może Pustka / Po’S+T+Ka!!!

Odpuszczam sobie dalsze gdybania, bo sam nie wiem, co jest ofitzjalnie gorsze… hehehe



puštík (język czeski)

puštík (1.1)


rzeczownik, rodzaj męski żywotny

(1.1) ornit. puszczyk







pustý +‎ -ík


puštík m anim

  1. an owl from the genus Strix






From Proto-Slavic *pustъ



  1. deserted






From Proto-Balto-Slavic *poustos (Derksen) / *paustas (author?), further etymology is unknown. Cognate with Old Prussian pausto (wild).



  1. emptydesolatevoid

Accent paradigm c.

Derived terms

Further reading
  1. Derksen, Rick (2008), “*pȗstъ”, in Etymological Dictionary of the Slavic Inherited Lexicon (Leiden Indo-European Etymological Dictionary Series; 4), Leiden, Boston: Brill, →ISBN, page 424: “adj. o (c) ‘empty, desolate’”



Wiktionary does not yet have a reconstruction page for Proto-Balto-Slavic/poustos.



Wiktionary does not yet have a reconstruction page for Proto-Balto-Slavic/paustas.


A oto trochę słów powiązanych z tym  ofitzjalnie nieznanym pierwotnym tzw. PIE źródłosłowem i jego znaczeniem. W tym pierwszym przypadku w j. polskim nie ma nawet zająknięcia skąd wzięła się nazwa Puszta,.. bo bo i po co, nieprawdaż?




(…) The word Puszta means „plains„, a vast wilderness of shrubs and grassland. The name comes from an adjective of the same form, meaning „waste, barren, bare”. Puszta is ultimately a Slavic loanword in Hungarian (compare Serbo-Croatian and Bulgarian pust and Polish pusty, both meaning bare or empty). (…)


Puszta / Po‚S”+Ta


puszta (język polski)


rzeczownik, rodzaj żeński

(1.1) geogr. step na Wielkiej Nizinie Węgierskiejzob. też puszta w Wikipedii
(1.1) blm

(1.1) węg. puszta[1]
(1.1) por. step • pampa • preria
  1.  Hasło puszta w: Słownik wyrazów obcych, Wydawnictwo Naukowe PWN, wyd. 1995 i nn.






puszta (plural pusztas)

  1. Alternative spelling of pusta



Borrowed from a Slavic language. Compare Serbo-Croatian pust and Polish pusty.[1]

  • IPA(key)[ˈpustɒ]
  • Hyphenation: pusz‧ta

puszta (comparative pusztábbsuperlative legpusztább)

  1. bare
    Synonyms: csupaszpőre
Derived terms

puszta (plural puszták)

  1. plain (an expanse of land with relatively low relief)
  2. (specifically, often capitalized) Pannonian Steppe
Inflection (stem in long/high vowel, back harmony)
singular plural
nominative puszta puszták
accusative pusztát pusztákat
dative pusztának pusztáknak
instrumental pusztával pusztákkal
causal-final pusztáért pusztákért
translative pusztává pusztákká
terminative pusztáig pusztákig
essive-formal pusztaként pusztákként
inessive pusztában pusztákban
superessive pusztán pusztákon
adessive pusztánál pusztáknál
illative pusztába pusztákba
sublative pusztára pusztákra
allative pusztához pusztákhoz
elative pusztából pusztákból
delative pusztáról pusztákról
ablative pusztától pusztáktól
possessive – singular
pusztáé pusztáké
possessive – plural
pusztáéi pusztákéi
Possessive forms of puszta
possessor single possession multiple possessions
1st person sing. pusztám pusztáim
2nd person sing. pusztád pusztáid
3rd person sing. pusztája pusztái
1st person plural pusztánk pusztáink
2nd person plural pusztátok pusztáitok
3rd person plural pusztájuk pusztáik
Derived terms
  1. Zaicz, Gábor. Etimológiai szótár: Magyar szavak és toldalékok eredete (’Dictionary of Etymology: The origin of Hungarian words and affixes’). Budapest: Tinta Könyvkiadó, 2006, →ISBN


Pusty / Po’S+Ty


pusty (język polski)

puste (1.1) butelki

pusta (1.1) droga

wymowa ?/iIPA[ˈpustɨ]AS[pusty]


(1.1) niezawierający niczego
(1.2) przen. nierozważnygłupibezmyślny
(1.3) gw. (Bukowinao dziecku: niegrzeczny[1]

(1.1) Zjadła zupę i teraz miska jest pusta.
(1.1) pusta struna • pusty dźwięk • pusty dom / pokój / … • pusta kartka • pusty żołądek
(1.2) pusty człowiek • pusty frazes / śmiech
(1.1) przest. próżny
(1.1) pełnywypełniony
wyrazy pokrewne:
rzecz. pustka żpustkowie npustynia żpustactwo npustość żpustota żpustak mos/mrzpustać ż
czas. pustoszyćopuszczaćopustoszyćspustoszyć
przym. pustackiopuszczonyopustoszałyspustoszonypuściuteńkipuściusieńkipuściutkipuściuśki
przysł. pustopustackopuściuteńkopuściutko
związki frazeologiczne:
mieć pustą kieszeń / mieć puste kieszenie • przelewać z pustego w próżne • z pustego i Salomon nie naleje • z pustego kłosa pszenicy nie wymłócisz • za Augusta ziemia pusta • biegać jak żyd po pustym sklepie • przyjść z pustymi rękami • odejść z pustymi rękami • zbiór pusty
prasł. pust
(1.2) zobacz listę tłumaczeń w haśle: głupi
(1.3) zobacz listę tłumaczeń w haśle: niegrzeczny
  1.  Zbigniew Greń, Helena Krasowska, Słownik górali polskich na Bukowinie, SOW, Warszawa 2008, s. 136; dostęp: 26 listopada 2018.


Pytanie za 100 punktów:

Dlaczego polski Puszczyk / Po’S”+C”+yK spalatalizował się w tzw. 13w,.. ale Pusty / Po’S+Ty nie i nie został Puscykiem / Po’S+Cy+K+ieM, hm?!! Czyż i tu i tu nie jest to jeden i ten sam Pra-Słowiański rdzeń, hm?




Lower Sorbian


From Proto-Slavic *pustъ (empty). Cognate with Upper Sorbian pustyPolish pustyCzech pustýOld Church Slavonic поустъ (pustŭ), and Russian пусто́й (pustój).


pusty (comparative pusćejšysuperlative nejpusćejšyadverb pusto)

  1. desolatedeserted
  2. empty (destitute of effect, sincerity, or sense)



From Proto-Slavic *pustъ.


pusty (comparative bardziej pustysuperlative najbardziej pustyadverb pusto)

  1. empty
  2. uninhabited
  3. (incomparable) blank (free from writing, printing, or marks; having an empty space to be filled in)
  4. hollow
Further reading
  • pusty in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • pusty in Polish dictionaries at PWN


Pusto / Po’S+To


pusto (język polski)



(1.1) także zauważalny jest brak czegoś lub kogoś
(1.2) w sposób nieprzemyślany
(1.1) zwykle w orzeczniku
(1.1) jałowo
(1.2) bezmyślniebeztroskogłupkowato
wyrazy pokrewne:
przym. pusty
rzecz. pustak mos/mrz







  1. emptily
Further reading
  • pusto in Polish dictionaries at PWN


Pustka / Po’S+T+Ka


pustka (język polski)

wymowa ?/i

rzeczownik, rodzaj żeński

(1.1) teren niezaludniony lub opuszczonyobszar niezagospodarowany
(1.2) pustaniewypełniona przestrzeń
(1.3) stan emocjonalny spowodowany utratą kogoś bliskiego

(1.1) dziuralukapróżnia
(1.1) istnienieobecnośćpełnia
wyrazy pokrewne:
rzecz. pustość żpustak mpustać żpustkowie npustelnik mos/mzwpustoszenie n
czas. pustoszyć
przym. pustypuściusieńkipuściuteńkipuściutkipuściuśki
przysł. pusto
związki frazeologiczne:
mieć pustkę w kieszeni / mieć pustki w kieszeni






pustka f

  1. void
  2. emptiness
Related terms
Further reading
  • pustka in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • pustka in Polish dictionaries at PWN


Język czeski, a także słowacki itd. utracił znaczenie słowa Pustka / Po’S+T+Ka i na określenie tego znaczenia używa innego słowa i rdzenia, patrz:













Wygląda na to, że słowo to pochodzi od rdzenia P+RG, jak Próg / P+Ro’G, a ten od RG / RZ”, czyli od… Pustego Rogu!!! Napiszę o tym oddzielny wpis!


Pustkowie / Po’S+T+Ko+Wie


pustkowie (język polski)

pustkowie (1.1)

pustkowie (1.1)

IPA[puˈstkɔvʲjɛ]AS[pustkovʹi ̯e], zjawiska fonetyczne: zmięk.• i → j 

rzeczownik, rodzaj nijaki

(1.1) książk. miejsce lub obszar niezamieszkany przez ludzipuste

(1.1) dom na pustkowiu
(1.1) bezludziedziczgłuszaodludziepustaćpustkapustyniadaw. puszcza
wyrazy pokrewne:
rzecz. pustka żpuszcza żpustak mos/mrzpustać ż
przym. pusty
czas. pustoszyć






From pustka +‎ -owie.

  • IPA(key)/puˈstkɔ.vʲɛ/

pustkowie n

  1. (literary) wastelanddesolation
Further reading
  • pustkowie in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • pustkowie in Polish dictionaries at PWN


Pustynia / Po’S+Ty+Nia


pustynia (język polski)

pustynia (1.1)

pustynia (1.3)

wymowa ?/iIPA[puˈstɨ̃ɲa]AS[pustńa], zjawiska fonetyczne: zmięk.• nazal.• -ni…

rzeczownik, rodzaj żeński

(1.1) geogr. teren niemal całkowicie pozbawiony roślinności na skutek małej ilości opadówzob. też pustynia w Wikipedii
(1.2) przen. teren niezamieszkanyniezagospodarowany[1]
(1.3) daw. mieszkanie pustelnikapustelnia[1]

(1.1) Przed wędrowcami rozciągała się Saharanajwiększa pustynia świata.
(1.2) Po wojnie Warszawa była prawdziwą pustynią.
(1.1) pustynia piaszczysta / kamienista / lodowa
(1.1) daw. puszcza
(1.2) pustkowie
(1.3) pustelnia
(1.1) serirhamadaergregkewirtakyrplaja
wyrazy pokrewne:
rzecz. pustynnik mpustynność żpustelnia żpustelnica żpustelnik mpustelniczka żpustka żpustynnienie n
czas. pustynnieć ndk.pustoszyć ndk.spustoszyć dk.pustoszeć ndk.
przym. pustynnypustypustelniczy
przysł. pustynniepustopustelniczo
  1. ↑ Skocz do:1,0 1,1 publikacja w otwartym dostępie – możesz ją przeczytać Hasło pustynia w: Słownik języka polskiego pod redakcją Witolda Doroszewskiego, Wydawnictwo Naukowe PWN.







From Proto-Slavic *pustyni


pustynia f

  1. desert (barren area)
Further reading
  • pustynia in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • pustynia in Polish dictionaries at PWN






*pustъ +‎ *-yni


*pustyni f

  1. desertwildernesswasteland


A teraz w nawiązaniu do Puszczyka dla porównania nazwy innych ptaków, których nazwy brzmią dziwnie podobnie… Dlaczego one nie spalatalizowały się jakoś w tym tzw. 13w, no do nie wiem… 🙂


Pustułka / Po’S+T+o’L”+Ka


pustułka (język polski)

pustułka (1.1)

pustułka (1.2)


rzeczownik, rodzaj żeński

(1.1) ornit. Falco tinnunculus[1]barwnydrapieżny ptak eurazjatyckizob. też pustułka zwyczajna w Wikipedii
(1.2) bot. rodzaj porostówzob. też Hypogymnia w Wikipedii

(1.1) W ostatnich latach coraz liczniej pustułki zimują również w Polsce wschodniej[2].
(1.2) Pustułka pęcherzykowata jest najbardziej rozpowszechnionym porostem listkowatym w Polsce (…)[3]
(1.1) pustułka zwyczajna
(1.2) pustułka brunatniejąca • pustułka Bittera • pustułka oprószona • pustułka pęcherzykowata • pustułka rurkowata • pustułka rozdęta
(1.1) zobacz też: Indeks:Polski – Ptaki
  1.  publikacja w otwartym dostępie – możesz ją przeczytać Hasło Falco tinnunculus w: Wikispecies – otwarty, wolny katalog gatunków, Wikimedia.
  2.  Pustułka, ptaki-rolnictwo.bocian.org.pl
  3.  Pustułka pęcherzykowata, przyrodniczek.pl





Puchacz / Po'(c)H+aC”


puchacz (język polski)

puchacz (1.1)


rzeczownik, rodzaj męskozwierzęcy

(1.1) ornit. największa występująca w Polsce sowazob. też puchacz w Wikipedii

rzeczownik, rodzaj męskoosobowy

(2.1) środ. oszust karciany grający nocą[1]

(1.1) Wrona gdzieniegdzie kracze i puchają puchacze[2].
(1.1) puchacz huka / pohukuje
(1.1) sowa
wyrazy pokrewne:
czas. puchać
st.pol. puhacz < st.pol. pohukanie[3]
(1.1) zobacz też: Indeks:Polski – Ptaki
  1.  Hasło puchacz w: Gry i zabawy środowisk dewiacyjnych w: Anna Piotrowicz, Słownictwo i frazeologia życia towarzyskiego w polskiej leksykografii XX wieku, s. 102, Poznań, Wydawnictwo Naukowe UAM, 2004, ISBN 83-232-1378-X.
  2.  Adam Mickiewicz: Lilie.
  3.  Maciej Malinowski, Jak ogurek stał się… ogórkiem!, „Obcy język polski”





Puchać / Po'(c)H+aC’


puchać (język polski)


czasownik nieprzechodni niedokonany

(1.1) neologizm hukać
(1.1) koniugacja I

(1.1) Wrona gdzieniegdzie kracze i puchają puchacze[1].
(1.1) Księżyc na młodziku i puchają puchaczeno bo ktoś musi puchać[2].
(1.1) hukać
wyrazy pokrewne:
rzecz. puchacz mpuchanie n
(1.1) pol. puchacz + hukać
(1.1) słowo nie jest powszechnie używane w języku polskim
(1.1) zobacz listę tłumaczeń w haśle: hukać
  1.  Adam MickiewiczLilie.
  2.  Konstanty Ildefons GałczyńskiStraszna ballada wielkanocna o zatopionej szynce, prawdopodobnie nawiązanie do Mickiewicza.


A teraz słowa, które są zbudowane na tym samym bezdźwięcznym rdzeniu P(c)H, ale niby nie mają tego samego znaczenia, co Puszcza / Po’S”+C”a, itp.


Puchnąć / Po'(c)H+Na”C’


puchć (język polski)

ręka puchnie (1.1)


czasownik przechodni niedokonany (dk. spuchnąć)

(1.1) stawać się obrzękniętym
(1.2) być przepełnionym
(1.3) pot. tracić siłysłabnąć
(1.1) Stary numer polegał na tym kilka godzin przed występem brało się duży kamień i waliło z dziesięciominutowymi przerwami w nadgarstek – czerwieniał i puchł błyskawicznie[1].
(1.1) nabrzmiewać
wyrazy pokrewne:
czas. spuchnąć
  1.  Mariusz Sieniewicz, Żydówek nie obsługujemy, 2005, Narodowy Korpus Języka Polskiego.






From Proto-Slavic *puxti.

  • IPA(key)/ˈpux.nɔɲt͡ɕ/

puchnąć impf (perfective opuchnąć or napuchnąć)

  1. (intransitive) to swell


Related terms
Further reading
  • puchnąć in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • puchnąć in Polish dictionaries at PWN






From Proto-Balto-Slavic *pauš + Proto-Slavic *-nǫti, from Proto-Indo-European *pews. Cognate with Lithuanian pũsti  (to blow), 1sg. pucpùsti (to inflate), 1sg. puntùpūslė̃ (blister, bladder)Norwegian føysa (to swell)Sanskrit  पुष्यति (púṣyatito thrive)Latin pustula (bubble), possibly Ancient Greek φῡσάω (phūsáōto snort)φῦσα (phûsabellows, bubble)Old Armenian փուք (pʿukʿbreath).



  1. to swell
  • 1sg. *puxnǫ

This verb needs an inflection-table template.

Related terms
  • *puxati (to swell? to blow?)


  • West Slavic:
  • Černyx, P. Ja. (1999), “пу́хнуть”, in Istoriko-etimologičeskij slovarʹ russkovo jazyka [Historical-Etymological Dictionary of the Russian Language] (in Russian), volume 2, 3rd reprint edition, Moscow: Russkij jazyk, page 85
  • Derksen, Rick (2008), “*puxnǫti”, in Etymological Dictionary of the Slavic Inherited Lexicon (Leiden Indo-European Etymological Dictionary Series; 4), Leiden, Boston: Brill, →ISBN, page 423
  • Vasmer (Fasmer), Max (Maks) (1964–1973), “пу́хнуть”, in Etimologičeskij slovarʹ russkovo jazyka [Etymological Dictionary of the Russian Language] (in Russian), translated from German and supplemented by Trubačóv Oleg, Moscow: Progress



Wiktionary does not yet have a reconstruction page for Proto-Balto-Slavic/pauš-.


Podaje tu tę bałto-słowiańska lipę jedynie jako przykład ofitzjalnie odtfoszonego dowodu potwierdzającego pierwotną wysokoenergetyczność rdzenia PS, wobec ofitzjalnie wtórnie ubezdźwięcznionego rdzenia P(c)H. Jak widać tzw. rough breathing działa, jak zwykle! 🙂






From Proto-Balto-Slavic *pauš + Proto-Slavic *-nǫti, from Proto-Indo-European *pews. Cognate with Lithuanian pũsti  (to blow), 1sg. pucpùsti (to inflate), 1sg. puntùpūslė̃ (blister, bladder)Norwegian føysa (to swell)Sanskrit  पुष्यति (púṣyatito thrive)Latin pustula (bubble), possibly Ancient Greek φῡσάω (phūsáōto snort)φῦσα (phûsabellows, bubble)Old Armenian փուք (pʿukʿbreath).


*puxàti impf[1][2]

  1. to blow? to swell?
Related terms
Derived terms
Further reading
  1. Derksen, Rick (2008), “*puxati”, in Etymological Dictionary of the Slavic Inherited Lexicon (Leiden Indo-European Etymological Dictionary Series; 4), Leiden, Boston: Brill, →ISBN, page 423: “v.”
  2. Snoj, Marko (2016), “pūhati”, in Slovenski etimološki slovar, Ljubljana: Inštitut za slovenski jezik Frana Ramovša ZRC SAZU, →ISBN: “*puxa̋ti”






Iterative counter-part of *puxati (to blow), from Proto-Indo-European *pews (to puff). The -x- is due to RUKI law. Cognate with Sanskrit पुष्यति (púṣyatito thrive) and akin to Ancient Greek φῡσᾰ́ω (phūsáōto blow, to swell)Lithuanian puškuoti (to puff)Latvian pūst (to blow, to whiff).


*pyxati impf (perfective *pyxnǫti)[1][2]

  1. to breath heavily
  2. to groan, to puff

Reanalyzed in later times among some descendants as:

Related terms
Derived terms
  • *sъpyxati (to lose breath (for animals) / air (for objects, e.g. ball or baloon))
  • *jьzpyxati (to exhale air heavily)
  • *vъpyxati (to inhale air heavily)
  • *zapyxati (to get difficulty breathing)
Further reading
  • Vasmer (Fasmer), Max (Maks) (1964–1973), “пыхать”, in Etimologičeskij slovarʹ russkovo jazyka [Etymological Dictionary of the Russian Language] (in Russian), translated from German and supplemented by Trubačóv Oleg, Moscow: Progress
  • Duridanov I., Račeva M., Todorov T., editors (1996), “пихам³”, in Български етимологичен речник [Bulgarian Etymological Dictionary] (in Bulgarian), volume 5, Sofia: Bulgarian Academy of Sciences, page 268
  1. Olander, Thomas (2001), “pyxati: pyšjǫ pyšjetь”, in Common Slavic accentological word list, Copenhagen: Editiones Olander: “a stønne (PR 133)”
  2. Snoj, Marko (2016), “píhati”, in Slovenski etimološki slovar, Ljubljana: Inštitut za slovenski jezik Frana Ramovša ZRC SAZU, →ISBN: “*pyxa̋ti”


A wiecie, czego mi tu brakuje? Pisałem już o tym np. tu:







From Proto-Balto-Slavic *piš, from Proto-Indo-European *pis, from *peys.

Baltic cognates include Lithuanian pìsti (to copulate) (1sg. pisù). Other Indo-European cognates include Sanskrit पिनष्टि  (pináṣṭito crush)Avestan 𐬀𐬥𐬙-‎ (pišant-pushing)Ancient Greek πτίσσω (ptíssōto winnow grain, to crush in a mortar)Latin pīnsō (to crush) (infinitive pīnsere), Middle High German vīsel (mortar).



  1. to push, to shove
Further reading
  • Černyx, P. Ja. (1999), “пиха́ть”, in Istoriko-etimologičeskij slovarʹ russkovo jazyka [Historical-Etymological Dictionary of the Russian Language] (in Russian), volume 2, 3rd reprint edition, Moscow: Russkij jazyk, page 36
  • Vasmer (Fasmer), Max (Maks) (1964–1973), “пиха́ть”, in Etimologičeskij slovarʹ russkovo jazyka [Etymological Dictionary of the Russian Language] (in Russian), translated from German and supplemented by Trubačóv Oleg, Moscow: Progress
  1. Derksen, Rick (2008), “*pьxati”, in Etymological Dictionary of the Slavic Inherited Lexicon (Leiden Indo-European Etymological Dictionary Series; 4), Leiden, Boston: Brill, →ISBN, page 426: “v. ‘push, shove’”
  2. Snoj, Marko (2016), “pháti”, in Slovenski etimološki slovar, Ljubljana: Inštitut za slovenski jezik Frana Ramovša ZRC SAZU, →ISBN: “*pьxa̋ti”


I jeszcze coś też jednocześnie obocznie puchatego i puszystego jak Puszczyk na koniec…


Puszysty / Po’S”+yS+Ty


puszysty (język polski)



(1.1) o miękkim i gęstym owłosieniufutrze lub sierści
(1.2) miękkilekkidelikatny[1]
(1.3) bujnyobfity
(1.4) miękki i wyrośnięty
(1.5) eufem. z otyłością

(1.2) Wieczorny powiew od morza jest chłodnyświatło jest miękkie i puszystespokojne[2].
(1.5) tęgikorpulentnyotyły
(1.5) szczupłychudy
wyrazy pokrewne:
rzecz. puszystość żpuch mrz
przysł. puszyściepuszysto
przym. puchowy
  1.  publikacja w otwartym dostępie – możesz ją przeczytać Hasło puszysty w: Słownik języka polskiego, Wydawnictwo Naukowe PWN.
  2.  Andrzej Bobkowski, Szkice piórkiem : (Francja 1940-1944), 1957, Narodowy Korpus Języka Polskiego.






From puch +‎ -ysty.


puszysty (comparative bardziej puszystysuperlative najbardziej puszysty)

  1. fluffy (soft and pleasant to the touch)
  2. (euphemistic) obeseplumpchubby
Further reading
  • puszysty in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • puszysty in Polish dictionaries at PWN


Puszek / Po’S”+eK


puszek (język polski)


rzeczownik, rodzaj męskorzeczowy

(1.1) zdrobn. od puch
(1.2) bardzo drobnydelikatny puch
(1.3) miękki płatek do pudrowania twarzy[1]


(1.2) Entomolog zaobserwował brak puszku na odnóżach leśnych pasikoników.
(1.3) Nigdzie nie widzę mojego puszkaktóry wczoraj upuściłam w garderobie przed spektaklem.
wyrazy pokrewne:
rzecz. puch mrzPuchatek mos
przym. puchowypuchaty
pol. puch + -ek
(1.1) dla języków nierozróżniających zdrobnień zobacz listę tłumaczeń w haśle: puch
  1.  publikacja w otwartym dostępie – możesz ją przeczytać Hasło puszek w: Słownik języka polskiego, Wydawnictwo Naukowe PWN.





Etymology 1

From puch +‎ -ek.


puszek m inan

  1. Diminutive of puch
Etymology 2


  1. genitive plural of puszka
Further reading
  • puszek in Polish dictionaries at PWN


Puchaty / Po'(c)H+aTy


puchaty (język polski)


przymiotnik jakościowy

(1.1) pokryty puchem[1]
(1.2) o kłębiastejpuszystej konsystencji

wyrazy pokrewne:
rzecz. puch mrzpuszek mrz
przym. puchowy
pol. puch + -aty
  1.  publikacja w otwartym dostępie – możesz ją przeczytać Hasło puchaty w: Słownik języka polskiego, Wydawnictwo Naukowe PWN.


Puch / Po'(c)H


puch (język polski)

puch (1.1)


rzeczownik, rodzaj męskorzeczowy

(1.1) ornit. rodzaj delikatnego pierza[1][2]
(1.2) zool. delikatne drobne owłosienie na skórze zwierząt[1]
(1.3) anat. pierwsze ludzkie owłosienie[1]
(1.4) bot. drobne włoski okrywające roślinę lub ich część[1][2]
(1.5) pot. coś o miękkiejpuszystej i delikatnej konsystencji[1]
(1.6) przen. śnieg

(1.1) Zarówno puchjak i pierze mogą pochodzić z gęsi lub kaczek[3].
(1.4) Duża ilość puchu z topoli zalega w studzienkach ulicznych.
(1.6) Biały puch upiększył miasto[4].
(1.1) puch hydrofobowy
(1.4) puch kielichowy
wyrazy pokrewne:
rzecz. puchowiec mPuchatek m

zdrobn. puszek m
przym. puchowypuchatypuszysty
  1. ↑ Skocz do:1,0 1,1 1,2 1,3 1,4 publikacja w otwartym dostępie – możesz ją przeczytać Hasło puch w: Słownik języka polskiego, Wydawnictwo Naukowe PWN.
  2. ↑ Skocz do:2,0 2,1 publikacja w otwartym dostępie – możesz ją przeczytać Hasło puch w: Słownik języka polskiego pod redakcją Witolda Doroszewskiego, Wydawnictwo Naukowe PWN.
  3.  4f.com.pl
  4.  www.gazetakrakowska.pl





Etymology 1

From Proto-Slavic *puxъ.


puch m inan (diminutive puszek)

  1. downfluff (soft, immature feathers)
  2. snow
Related terms
Etymology 2


  1. genitive plural of pucha
Further reading
  • puch in Wielki słownik języka polskiego, Instytut Języka Polskiego PAN
  • puch in Polish dictionaries at PWN





Etymology 1

From Proto-Indo-European *pows (to swell, to blow) or from an onomatopoeic origin.


*puxъ m

  1. breathpong
  2. blister
Related terms
  • Todorov T., editor (2010), “пух²”, in Български етимологичен речник [Bulgarian Etymological Dictionary] (in Bulgarian), volume 7, Sofia: Bulgarian Academy of Sciences
Etymology 2

From Proto-Indo-European *pews (fluff, tail). Cognate with Proto-Germanic *fuhsaz (fox)Proto-Indo-Iranian *púsćas (tail).


*puxъ m

  1. flufffur (of mammals)
  2. down (of birds)
Derived terms
  • Vasmer (Fasmer), Max (Maks) (1964–1973), “пух”, in Etimologičeskij slovarʹ russkovo jazyka [Etymological Dictionary of the Russian Language] (in Russian), translated from German and supplemented by Trubačóv Oleg, Moscow: Progress
  • Todorov T., editor (2010), “пух¹”, in Български етимологичен речник [Bulgarian Etymological Dictionary] (in Bulgarian), volume 7, Sofia: Bulgarian Academy of Sciences



Wiktionary does not yet have a reconstruction page for Proto-Indo-European/pews-.



Wiktionary does not yet have a reconstruction page for Proto-Indo-European/pews-.


To jeszcze wcale nie koniec. Wstańcie z goleni i kolan i Postójcie ze mną, a zaprawdę powiadam Wam, że Powstając, wcale nie będziecie pościć stojąc! 🙂





Wprowadź swoje dane lub kliknij jedną z tych ikon, aby się zalogować:

Logo WordPress.com

Komentujesz korzystając z konta WordPress.com. Wyloguj /  Zmień )

Zdjęcie z Twittera

Komentujesz korzystając z konta Twitter. Wyloguj /  Zmień )

Zdjęcie na Facebooku

Komentujesz korzystając z konta Facebook. Wyloguj /  Zmień )

Połączenie z %s

Ta witryna wykorzystuje usługę Akismet aby zredukować ilość spamu. Dowiedz się w jaki sposób dane w twoich komentarzach są przetwarzane.